Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1816674..1817367 | Replicon | chromosome |
| Accession | NZ_CP110069 | ||
| Organism | Enterococcus faecalis strain BE11 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | A0A2Z6BTE2 |
| Locus tag | OLL93_RS08975 | Protein ID | WP_002364356.1 |
| Coordinates | 1817023..1817367 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLL93_RS08970 | Protein ID | WP_002364355.1 |
| Coordinates | 1816674..1817006 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL93_RS08925 (1812144) | 1812144..1812878 | - | 735 | WP_002364345.1 | ERF family protein | - |
| OLL93_RS08930 (1812871) | 1812871..1813188 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| OLL93_RS08935 (1813408) | 1813408..1813962 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| OLL93_RS08940 (1814247) | 1814247..1814585 | - | 339 | WP_002364347.1 | hypothetical protein | - |
| OLL93_RS08945 (1814622) | 1814622..1814831 | - | 210 | WP_002399426.1 | hypothetical protein | - |
| OLL93_RS08950 (1814886) | 1814886..1815074 | + | 189 | WP_002364350.1 | YegP family protein | - |
| OLL93_RS08955 (1815100) | 1815100..1815825 | - | 726 | WP_002364352.1 | phage regulatory protein | - |
| OLL93_RS08960 (1815864) | 1815864..1816175 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL93_RS08965 (1816186) | 1816186..1816362 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL93_RS08970 (1816674) | 1816674..1817006 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL93_RS08975 (1817023) | 1817023..1817367 | + | 345 | WP_002364356.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| OLL93_RS08980 (1817461) | 1817461..1818366 | + | 906 | WP_016630909.1 | DUF4352 domain-containing protein | - |
| OLL93_RS08985 (1818426) | 1818426..1818500 | + | 75 | Protein_1740 | ImmA/IrrE family metallo-endopeptidase | - |
| OLL93_RS08990 (1818534) | 1818534..1819262 | + | 729 | WP_002364358.1 | potassium channel family protein | - |
| OLL93_RS08995 (1819359) | 1819359..1820507 | + | 1149 | WP_002364359.1 | site-specific integrase | - |
| OLL93_RS09000 (1820535) | 1820535..1820978 | - | 444 | WP_002356992.1 | competence type IV pilus minor pilin ComGD | - |
| OLL93_RS09005 (1820975) | 1820975..1821250 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| OLL93_RS09010 (1821250) | 1821250..1822296 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1781707..1839355 | 57648 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13704.62 Da Isoelectric Point: 5.8535
>T263007 WP_002364356.1 NZ_CP110069:1817023-1817367 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|