263007

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1816674..1817367 Replicon chromosome
Accession NZ_CP110069
Organism Enterococcus faecalis strain BE11

Toxin (Protein)


Gene name IrrE Uniprot ID A0A2Z6BTE2
Locus tag OLL93_RS08975 Protein ID WP_002364356.1
Coordinates 1817023..1817367 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL93_RS08970 Protein ID WP_002364355.1
Coordinates 1816674..1817006 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL93_RS08925 (1812144) 1812144..1812878 - 735 WP_002364345.1 ERF family protein -
OLL93_RS08930 (1812871) 1812871..1813188 - 318 WP_002357007.1 hypothetical protein -
OLL93_RS08935 (1813408) 1813408..1813962 + 555 WP_002357006.1 hypothetical protein -
OLL93_RS08940 (1814247) 1814247..1814585 - 339 WP_002364347.1 hypothetical protein -
OLL93_RS08945 (1814622) 1814622..1814831 - 210 WP_002399426.1 hypothetical protein -
OLL93_RS08950 (1814886) 1814886..1815074 + 189 WP_002364350.1 YegP family protein -
OLL93_RS08955 (1815100) 1815100..1815825 - 726 WP_002364352.1 phage regulatory protein -
OLL93_RS08960 (1815864) 1815864..1816175 - 312 WP_002381719.1 hypothetical protein -
OLL93_RS08965 (1816186) 1816186..1816362 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL93_RS08970 (1816674) 1816674..1817006 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL93_RS08975 (1817023) 1817023..1817367 + 345 WP_002364356.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL93_RS08980 (1817461) 1817461..1818366 + 906 WP_016630909.1 DUF4352 domain-containing protein -
OLL93_RS08985 (1818426) 1818426..1818500 + 75 Protein_1740 ImmA/IrrE family metallo-endopeptidase -
OLL93_RS08990 (1818534) 1818534..1819262 + 729 WP_002364358.1 potassium channel family protein -
OLL93_RS08995 (1819359) 1819359..1820507 + 1149 WP_002364359.1 site-specific integrase -
OLL93_RS09000 (1820535) 1820535..1820978 - 444 WP_002356992.1 competence type IV pilus minor pilin ComGD -
OLL93_RS09005 (1820975) 1820975..1821250 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL93_RS09010 (1821250) 1821250..1822296 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1781707..1839355 57648


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13704.62 Da        Isoelectric Point: 5.8535

>T263007 WP_002364356.1 NZ_CP110069:1817023-1817367 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT263007 WP_002364355.1 NZ_CP110069:1816674-1817006 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6BTE2

Antitoxin

Source ID Structure

References