Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 388690..389272 | Replicon | chromosome |
Accession | NZ_CP110069 | ||
Organism | Enterococcus faecalis strain BE11 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | OLL93_RS01975 | Protein ID | WP_002355414.1 |
Coordinates | 388964..389272 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | OLL93_RS01970 | Protein ID | WP_002326825.1 |
Coordinates | 388690..388962 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL93_RS01950 (383909) | 383909..384310 | - | 402 | WP_002364925.1 | sigma-70 family RNA polymerase sigma factor | - |
OLL93_RS01960 (387533) | 387533..388387 | + | 855 | WP_002364921.1 | ParA family protein | - |
OLL93_RS01965 (388458) | 388458..388673 | + | 216 | WP_002364919.1 | peptide-binding protein | - |
OLL93_RS01970 (388690) | 388690..388962 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
OLL93_RS01975 (388964) | 388964..389272 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
OLL93_RS01980 (389352) | 389352..389774 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
OLL93_RS01985 (389825) | 389825..390325 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
OLL93_RS01990 (390330) | 390330..391097 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OLL93_RS01995 (391585) | 391585..392010 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
OLL93_RS02000 (392027) | 392027..392542 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
OLL93_RS02005 (392553) | 392553..393485 | + | 933 | WP_264522665.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T263004 WP_002355414.1 NZ_CP110069:388964-389272 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |