Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2583453..2584138 | Replicon | chromosome |
| Accession | NZ_CP110068 | ||
| Organism | Enterococcus faecalis strain BE13 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | OLM02_RS12720 | Protein ID | WP_016634626.1 |
| Coordinates | 2583794..2584138 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLM02_RS12715 | Protein ID | WP_010826721.1 |
| Coordinates | 2583453..2583776 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM02_RS12670 (2578771) | 2578771..2579550 | - | 780 | WP_142959398.1 | DnaD domain protein | - |
| OLM02_RS12675 (2579565) | 2579565..2580380 | - | 816 | WP_002365125.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| OLM02_RS12680 (2580343) | 2580343..2581308 | - | 966 | WP_010717378.1 | RecT family recombinase | - |
| OLM02_RS12685 (2581409) | 2581409..2581633 | - | 225 | WP_002367281.1 | hypothetical protein | - |
| OLM02_RS12690 (2581742) | 2581742..2582158 | - | 417 | WP_002370016.1 | hypothetical protein | - |
| OLM02_RS12695 (2582352) | 2582352..2582495 | - | 144 | WP_162837301.1 | hypothetical protein | - |
| OLM02_RS12700 (2582506) | 2582506..2582682 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLM02_RS12705 (2582759) | 2582759..2582968 | + | 210 | WP_010731659.1 | hypothetical protein | - |
| OLM02_RS12710 (2582965) | 2582965..2583147 | - | 183 | WP_264522709.1 | hypothetical protein | - |
| OLM02_RS12715 (2583453) | 2583453..2583776 | + | 324 | WP_010826721.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLM02_RS12720 (2583794) | 2583794..2584138 | + | 345 | WP_016634626.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| OLM02_RS12725 (2584173) | 2584173..2584901 | + | 729 | WP_010826723.1 | potassium channel family protein | - |
| OLM02_RS12730 (2584996) | 2584996..2586363 | + | 1368 | WP_142959721.1 | recombinase family protein | - |
| OLM02_RS12735 (2586385) | 2586385..2586960 | - | 576 | WP_002393061.1 | DNA repair protein RadC | - |
| OLM02_RS12740 (2586992) | 2586992..2587651 | - | 660 | WP_002398690.1 | HAD family hydrolase | - |
| OLM02_RS12745 (2587635) | 2587635..2588957 | - | 1323 | WP_010821842.1 | folylpolyglutamate synthase/dihydrofolate synthase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2544049..2586363 | 42314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13667.60 Da Isoelectric Point: 6.2208
>T262992 WP_016634626.1 NZ_CP110068:2583794-2584138 [Enterococcus faecalis]
MKSIKELVEEYNVELVFAPINKRACYESVKRIIFVNQNLSIEEQEEAIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKNDGQFNYSNVITHYNLKMGQENYLK
MKSIKELVEEYNVELVFAPINKRACYESVKRIIFVNQNLSIEEQEEAIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKNDGQFNYSNVITHYNLKMGQENYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|