Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 426466..427048 | Replicon | chromosome |
Accession | NZ_CP110068 | ||
Organism | Enterococcus faecalis strain BE13 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | OLM02_RS02190 | Protein ID | WP_002355414.1 |
Coordinates | 426740..427048 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | OLM02_RS02185 | Protein ID | WP_002326825.1 |
Coordinates | 426466..426738 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM02_RS02160 (422208) | 422208..422447 | + | 240 | WP_250864631.1 | DNA topoisomerase | - |
OLM02_RS02165 (422540) | 422540..423823 | + | 1284 | WP_010822049.1 | type IA DNA topoisomerase | - |
OLM02_RS02175 (425309) | 425309..426163 | + | 855 | WP_010822050.1 | ParA family protein | - |
OLM02_RS02180 (426234) | 426234..426449 | + | 216 | WP_002355411.1 | peptide-binding protein | - |
OLM02_RS02185 (426466) | 426466..426738 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
OLM02_RS02190 (426740) | 426740..427048 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
OLM02_RS02195 (427128) | 427128..427550 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
OLM02_RS02200 (427601) | 427601..428101 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
OLM02_RS02205 (428106) | 428106..428873 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OLM02_RS02210 (429363) | 429363..429788 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
OLM02_RS02215 (429805) | 429805..430320 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
OLM02_RS02220 (430331) | 430331..431263 | + | 933 | WP_010822051.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T262989 WP_002355414.1 NZ_CP110068:426740-427048 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |