Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 433213..433765 | Replicon | chromosome |
| Accession | NZ_CP110063 | ||
| Organism | Enterococcus faecalis strain BE15 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | OLL96_RS02245 | Protein ID | WP_002355414.1 |
| Coordinates | 433457..433765 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | - |
| Locus tag | OLL96_RS02240 | Protein ID | WP_034439854.1 |
| Coordinates | 433213..433455 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL96_RS02220 (428864) | 428864..430540 | + | 1677 | WP_010709001.1 | type IA DNA topoisomerase | - |
| OLL96_RS02230 (432026) | 432026..432880 | + | 855 | WP_002364921.1 | ParA family protein | - |
| OLL96_RS02235 (432951) | 432951..433166 | + | 216 | WP_002364919.1 | peptide-binding protein | - |
| OLL96_RS02240 (433213) | 433213..433455 | + | 243 | WP_034439854.1 | antitoxin | Antitoxin |
| OLL96_RS02245 (433457) | 433457..433765 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| OLL96_RS02250 (433845) | 433845..434267 | - | 423 | WP_229236149.1 | tyrosine-type recombinase/integrase | - |
| OLL96_RS02255 (434318) | 434318..434818 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
| OLL96_RS02260 (434823) | 434823..435590 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OLL96_RS02265 (436070) | 436070..436495 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| OLL96_RS02270 (436512) | 436512..437027 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| OLL96_RS02275 (437038) | 437038..437970 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | ClpL | - | 376842..434818 | 57976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T262961 WP_002355414.1 NZ_CP110063:433457-433765 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|