Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 87452..87986 Replicon plasmid pBE16_1
Accession NZ_CP110060
Organism Enterococcus faecalis strain BE16

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag OLL92_RS14415 Protein ID WP_002360769.1
Coordinates 87711..87986 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag OLL92_RS14410 Protein ID WP_002369771.1
Coordinates 87452..87718 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL92_RS14365 (OLL92_14365) 82903..83583 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
OLL92_RS14370 (OLL92_14370) 83724..83864 + 141 WP_236545660.1 hypothetical protein -
OLL92_RS14375 (OLL92_14375) 83870..84358 + 489 WP_002401725.1 hypothetical protein -
OLL92_RS14380 (OLL92_14380) 84950..85216 + 267 WP_002360776.1 hypothetical protein -
OLL92_RS14385 (OLL92_14385) 85249..85749 + 501 WP_002360775.1 DnaJ domain-containing protein -
OLL92_RS14390 (OLL92_14390) 85762..86010 + 249 WP_002417063.1 DUF3850 domain-containing protein -
OLL92_RS14395 (OLL92_14395) 86086..86502 + 417 WP_010783056.1 single-stranded DNA-binding protein -
OLL92_RS14400 (OLL92_14400) 86526..87104 + 579 WP_010826348.1 thermonuclease family protein -
OLL92_RS14405 (OLL92_14405) 87101..87349 + 249 WP_002369773.1 hypothetical protein -
OLL92_RS14410 (OLL92_14410) 87452..87718 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OLL92_RS14415 (OLL92_14415) 87711..87986 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
OLL92_RS14420 (OLL92_14420) 88790..88975 + 186 WP_002360767.1 hypothetical protein -
OLL92_RS14425 (OLL92_14425) 88960..89151 + 192 WP_002401572.1 DpnD/PcfM family protein -
OLL92_RS14430 (OLL92_14430) 89382..90161 + 780 WP_104884702.1 Cas9 inhibitor AcrIIA9 family protein -
OLL92_RS14435 (OLL92_14435) 90161..91420 + 1260 WP_002404730.1 PcfJ domain-containing protein -
OLL92_RS14440 (OLL92_14440) 92069..92797 + 729 WP_010713080.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..102346 102346


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T262960 WP_002360769.1 NZ_CP110060:87711-87986 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT262960 WP_002369771.1 NZ_CP110060:87452-87718 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References