Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 68467..69038 Replicon plasmid pBE16_1
Accession NZ_CP110060
Organism Enterococcus faecalis strain BE16

Toxin (Protein)


Gene name mazF Uniprot ID S4H3R9
Locus tag OLL92_RS14275 Protein ID WP_010784114.1
Coordinates 68697..69038 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag OLL92_RS14270 Protein ID WP_002362431.1
Coordinates 68467..68697 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL92_RS14235 (OLL92_14235) 64253..64909 + 657 WP_240185281.1 TraB/GumN family protein -
OLL92_RS14240 (OLL92_14240) 64938..65180 + 243 WP_240185280.1 hypothetical protein -
OLL92_RS14250 (OLL92_14250) 66803..66982 - 180 WP_104858764.1 transcriptional regulator -
OLL92_RS14255 (OLL92_14255) 67092..67355 - 264 WP_104858763.1 hypothetical protein -
OLL92_RS14260 (OLL92_14260) 67342..67653 - 312 WP_033628686.1 hypothetical protein -
OLL92_RS14265 (OLL92_14265) 67643..68263 - 621 WP_161971889.1 recombinase family protein -
OLL92_RS14270 (OLL92_14270) 68467..68697 + 231 WP_002362431.1 hypothetical protein Antitoxin
OLL92_RS14275 (OLL92_14275) 68697..69038 + 342 WP_010784114.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OLL92_RS14280 (OLL92_14280) 69150..69617 + 468 WP_264547814.1 hypothetical protein -
OLL92_RS14285 (OLL92_14285) 69670..70089 + 420 WP_264547815.1 hypothetical protein -
OLL92_RS14290 (OLL92_14290) 70354..70956 + 603 WP_002362434.1 Fic family protein -
OLL92_RS14295 (OLL92_14295) 71429..72388 - 960 WP_000221326.1 IS30-like element IS6770 family transposase -
OLL92_RS14300 (OLL92_14300) 72446..72859 + 414 WP_264547816.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..102346 102346
- inside IScluster/Tn - - 53792..72388 18596


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13270.47 Da        Isoelectric Point: 7.9750

>T262959 WP_010784114.1 NZ_CP110060:68697-69038 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT262959 WP_002362431.1 NZ_CP110060:68467-68697 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4H3R9

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References