Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2752408..2752979 | Replicon | chromosome |
| Accession | NZ_CP110059 | ||
| Organism | Enterococcus faecalis strain BE16 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OLL92_RS13410 | Protein ID | WP_002354774.1 |
| Coordinates | 2752408..2752749 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | OLL92_RS13415 | Protein ID | WP_104875562.1 |
| Coordinates | 2752749..2752979 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL92_RS13405 (2748423) | 2748423..2752037 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| OLL92_RS13410 (2752408) | 2752408..2752749 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OLL92_RS13415 (2752749) | 2752749..2752979 | - | 231 | WP_104875562.1 | AbrB family transcriptional regulator | Antitoxin |
| OLL92_RS13420 (2753386) | 2753386..2753601 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| OLL92_RS13425 (2753740) | 2753740..2754732 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLL92_RS13430 (2754799) | 2754799..2755431 | - | 633 | WP_002358972.1 | RloB family protein | - |
| OLL92_RS13435 (2755440) | 2755440..2756735 | - | 1296 | WP_010820355.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T262944 WP_002354774.1 NZ_CP110059:c2752749-2752408 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|