262941

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1492638..1493331 Replicon chromosome
Accession NZ_CP110059
Organism Enterococcus faecalis strain BE16

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag OLL92_RS07275 Protein ID WP_002378467.1
Coordinates 1492638..1492982 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL92_RS07280 Protein ID WP_002364355.1
Coordinates 1492999..1493331 (-) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL92_RS07245 (1487912) 1487912..1488880 + 969 WP_002369168.1 competence type IV pilus ATPase ComGA -
OLL92_RS07250 (1488837) 1488837..1489883 + 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
OLL92_RS07255 (1489883) 1489883..1490158 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL92_RS07260 (1490155) 1490155..1490589 + 435 Protein_1409 competence type IV pilus minor pilin ComGD -
OLL92_RS07265 (1490626) 1490626..1491774 - 1149 WP_002378469.1 site-specific integrase -
OLL92_RS07270 (1491874) 1491874..1492602 - 729 WP_002381717.1 potassium channel family protein -
OLL92_RS07275 (1492638) 1492638..1492982 - 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL92_RS07280 (1492999) 1492999..1493331 - 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL92_RS07285 (1493643) 1493643..1493819 + 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL92_RS07290 (1493830) 1493830..1494141 + 312 WP_002381719.1 hypothetical protein -
OLL92_RS07295 (1494180) 1494180..1494902 + 723 WP_002410531.1 ORF6C domain-containing protein -
OLL92_RS07300 (1494928) 1494928..1495116 - 189 WP_002357001.1 YegP family protein -
OLL92_RS07305 (1495171) 1495171..1495380 + 210 WP_002378465.1 hypothetical protein -
OLL92_RS07310 (1495417) 1495417..1495755 + 339 WP_002402484.1 hypothetical protein -
OLL92_RS07315 (1495951) 1495951..1496268 + 318 WP_002402485.1 hypothetical protein -
OLL92_RS07320 (1496261) 1496261..1496995 + 735 WP_002402486.1 ERF family protein -
OLL92_RS07325 (1497000) 1497000..1497641 + 642 WP_002402487.1 putative HNHc nuclease -
OLL92_RS07330 (1497646) 1497646..1497846 + 201 WP_010715320.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1490182..1528716 38534


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T262941 WP_002378467.1 NZ_CP110059:c1492982-1492638 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT262941 WP_002364355.1 NZ_CP110059:c1493331-1492999 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References