Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 23438..23972 Replicon plasmid pBE17_2
Accession NZ_CP110056
Organism Enterococcus faecalis strain BE17

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag OLL95_RS14355 Protein ID WP_002360769.1
Coordinates 23697..23972 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag OLL95_RS14350 Protein ID WP_002369771.1
Coordinates 23438..23704 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL95_RS14310 (OLL95_14310) 19067..19852 + 786 WP_002360778.1 replication-relaxation family protein -
OLL95_RS14315 (OLL95_14315) 19858..20346 + 489 WP_002401725.1 hypothetical protein -
OLL95_RS14320 (OLL95_14320) 20938..21204 + 267 WP_002360776.1 hypothetical protein -
OLL95_RS14325 (OLL95_14325) 21237..21737 + 501 WP_002360775.1 DnaJ domain-containing protein -
OLL95_RS14330 (OLL95_14330) 21750..21998 + 249 WP_002417063.1 DUF3850 domain-containing protein -
OLL95_RS14335 (OLL95_14335) 22074..22490 + 417 WP_010783056.1 single-stranded DNA-binding protein -
OLL95_RS14340 (OLL95_14340) 22514..23092 + 579 WP_010826348.1 thermonuclease family protein -
OLL95_RS14345 (OLL95_14345) 23089..23337 + 249 WP_002369773.1 hypothetical protein -
OLL95_RS14350 (OLL95_14350) 23438..23704 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OLL95_RS14355 (OLL95_14355) 23697..23972 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
OLL95_RS14360 (OLL95_14360) 24776..24961 + 186 WP_002360767.1 hypothetical protein -
OLL95_RS14365 (OLL95_14365) 24946..25137 + 192 WP_002401572.1 DpnD/PcfM family protein -
OLL95_RS14370 (OLL95_14370) 25368..26147 + 780 WP_104884702.1 Cas9 inhibitor AcrIIA9 family protein -
OLL95_RS14375 (OLL95_14375) 26147..27406 + 1260 WP_002404730.1 PcfJ domain-containing protein -
OLL95_RS14380 (OLL95_14380) 28055..28783 + 729 WP_010713080.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..45460 45460


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T262937 WP_002360769.1 NZ_CP110056:23697-23972 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT262937 WP_002369771.1 NZ_CP110056:23438-23704 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References