Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 19465..20036 | Replicon | plasmid pBE17_1 |
Accession | NZ_CP110055 | ||
Organism | Enterococcus faecalis strain BE17 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S4H3R9 |
Locus tag | OLL95_RS13980 | Protein ID | WP_010784114.1 |
Coordinates | 19695..20036 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3KHK9 |
Locus tag | OLL95_RS13975 | Protein ID | WP_002362431.1 |
Coordinates | 19465..19695 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL95_RS13940 (OLL95_13940) | 15251..15907 | + | 657 | WP_240185281.1 | TraB/GumN family protein | - |
OLL95_RS13945 (OLL95_13945) | 15936..16178 | + | 243 | WP_240185280.1 | hypothetical protein | - |
OLL95_RS13955 (OLL95_13955) | 17801..17980 | - | 180 | WP_104858764.1 | transcriptional regulator | - |
OLL95_RS13960 (OLL95_13960) | 18090..18353 | - | 264 | WP_104858763.1 | hypothetical protein | - |
OLL95_RS13965 (OLL95_13965) | 18340..18651 | - | 312 | WP_033628686.1 | hypothetical protein | - |
OLL95_RS13970 (OLL95_13970) | 18641..19261 | - | 621 | WP_161971889.1 | recombinase family protein | - |
OLL95_RS13975 (OLL95_13975) | 19465..19695 | + | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
OLL95_RS13980 (OLL95_13980) | 19695..20036 | + | 342 | WP_010784114.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OLL95_RS13985 (OLL95_13985) | 20148..20615 | + | 468 | WP_264547814.1 | hypothetical protein | - |
OLL95_RS13990 (OLL95_13990) | 20668..21087 | + | 420 | WP_264547815.1 | hypothetical protein | - |
OLL95_RS13995 (OLL95_13995) | 21352..21954 | + | 603 | WP_002362434.1 | Fic family protein | - |
OLL95_RS14000 (OLL95_14000) | 22427..23386 | - | 960 | WP_000221326.1 | IS30-like element IS6770 family transposase | - |
OLL95_RS14005 (OLL95_14005) | 23444..23857 | + | 414 | WP_264547816.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..56232 | 56232 | |
- | inside | IScluster/Tn | - | - | 4790..23386 | 18596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13270.47 Da Isoelectric Point: 7.9750
>T262936 WP_010784114.1 NZ_CP110055:19695-20036 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|