Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2752343..2752914 | Replicon | chromosome |
Accession | NZ_CP110054 | ||
Organism | Enterococcus faecalis strain BE17 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OLL95_RS13410 | Protein ID | WP_002354774.1 |
Coordinates | 2752343..2752684 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | OLL95_RS13415 | Protein ID | WP_104875562.1 |
Coordinates | 2752684..2752914 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL95_RS13405 (2748358) | 2748358..2751972 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
OLL95_RS13410 (2752343) | 2752343..2752684 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OLL95_RS13415 (2752684) | 2752684..2752914 | - | 231 | WP_104875562.1 | AbrB family transcriptional regulator | Antitoxin |
OLL95_RS13420 (2753321) | 2753321..2753536 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
OLL95_RS13425 (2753675) | 2753675..2754667 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
OLL95_RS13430 (2754734) | 2754734..2755366 | - | 633 | WP_002358972.1 | RloB family protein | - |
OLL95_RS13435 (2755375) | 2755375..2756670 | - | 1296 | WP_010820355.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T262921 WP_002354774.1 NZ_CP110054:c2752684-2752343 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|