Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1492589..1493282 | Replicon | chromosome |
| Accession | NZ_CP110054 | ||
| Organism | Enterococcus faecalis strain BE17 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | OLL95_RS07275 | Protein ID | WP_002378467.1 |
| Coordinates | 1492589..1492933 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLL95_RS07280 | Protein ID | WP_002364355.1 |
| Coordinates | 1492950..1493282 (-) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL95_RS07245 (1487863) | 1487863..1488831 | + | 969 | WP_002369168.1 | competence type IV pilus ATPase ComGA | - |
| OLL95_RS07250 (1488788) | 1488788..1489834 | + | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| OLL95_RS07255 (1489834) | 1489834..1490109 | + | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| OLL95_RS07260 (1490106) | 1490106..1490540 | + | 435 | Protein_1410 | competence type IV pilus minor pilin ComGD | - |
| OLL95_RS07265 (1490577) | 1490577..1491725 | - | 1149 | WP_002378469.1 | site-specific integrase | - |
| OLL95_RS07270 (1491825) | 1491825..1492553 | - | 729 | WP_002381717.1 | potassium channel family protein | - |
| OLL95_RS07275 (1492589) | 1492589..1492933 | - | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| OLL95_RS07280 (1492950) | 1492950..1493282 | - | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL95_RS07285 (1493594) | 1493594..1493770 | + | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL95_RS07290 (1493781) | 1493781..1494092 | + | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL95_RS07295 (1494131) | 1494131..1494853 | + | 723 | WP_002410531.1 | ORF6C domain-containing protein | - |
| OLL95_RS07300 (1494879) | 1494879..1495067 | - | 189 | WP_002357001.1 | YegP family protein | - |
| OLL95_RS07305 (1495122) | 1495122..1495331 | + | 210 | WP_002378465.1 | hypothetical protein | - |
| OLL95_RS07310 (1495368) | 1495368..1495706 | + | 339 | WP_002402484.1 | hypothetical protein | - |
| OLL95_RS07315 (1495902) | 1495902..1496219 | + | 318 | WP_002402485.1 | hypothetical protein | - |
| OLL95_RS07320 (1496212) | 1496212..1496946 | + | 735 | WP_002402486.1 | ERF family protein | - |
| OLL95_RS07325 (1496951) | 1496951..1497592 | + | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| OLL95_RS07330 (1497597) | 1497597..1497797 | + | 201 | WP_010715320.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T262918 WP_002378467.1 NZ_CP110054:c1492933-1492589 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|