262918

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1492589..1493282 Replicon chromosome
Accession NZ_CP110054
Organism Enterococcus faecalis strain BE17

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag OLL95_RS07275 Protein ID WP_002378467.1
Coordinates 1492589..1492933 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL95_RS07280 Protein ID WP_002364355.1
Coordinates 1492950..1493282 (-) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL95_RS07245 (1487863) 1487863..1488831 + 969 WP_002369168.1 competence type IV pilus ATPase ComGA -
OLL95_RS07250 (1488788) 1488788..1489834 + 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
OLL95_RS07255 (1489834) 1489834..1490109 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL95_RS07260 (1490106) 1490106..1490540 + 435 Protein_1410 competence type IV pilus minor pilin ComGD -
OLL95_RS07265 (1490577) 1490577..1491725 - 1149 WP_002378469.1 site-specific integrase -
OLL95_RS07270 (1491825) 1491825..1492553 - 729 WP_002381717.1 potassium channel family protein -
OLL95_RS07275 (1492589) 1492589..1492933 - 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL95_RS07280 (1492950) 1492950..1493282 - 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL95_RS07285 (1493594) 1493594..1493770 + 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL95_RS07290 (1493781) 1493781..1494092 + 312 WP_002381719.1 hypothetical protein -
OLL95_RS07295 (1494131) 1494131..1494853 + 723 WP_002410531.1 ORF6C domain-containing protein -
OLL95_RS07300 (1494879) 1494879..1495067 - 189 WP_002357001.1 YegP family protein -
OLL95_RS07305 (1495122) 1495122..1495331 + 210 WP_002378465.1 hypothetical protein -
OLL95_RS07310 (1495368) 1495368..1495706 + 339 WP_002402484.1 hypothetical protein -
OLL95_RS07315 (1495902) 1495902..1496219 + 318 WP_002402485.1 hypothetical protein -
OLL95_RS07320 (1496212) 1496212..1496946 + 735 WP_002402486.1 ERF family protein -
OLL95_RS07325 (1496951) 1496951..1497592 + 642 WP_002402487.1 putative HNHc nuclease -
OLL95_RS07330 (1497597) 1497597..1497797 + 201 WP_010715320.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T262918 WP_002378467.1 NZ_CP110054:c1492933-1492589 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT262918 WP_002364355.1 NZ_CP110054:c1493282-1492950 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References