Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2354276..2355312 | Replicon | chromosome |
| Accession | NZ_CP110053 | ||
| Organism | Enterococcus faecalis strain BE25 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | R3K9G6 |
| Locus tag | OLL87_RS11405 | Protein ID | WP_002365229.1 |
| Coordinates | 2354659..2355312 (+) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLL87_RS11400 | Protein ID | WP_083578778.1 |
| Coordinates | 2354276..2354662 (+) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL87_RS11360 (2350616) | 2350616..2350996 | - | 381 | WP_002402315.1 | DUF86 domain-containing protein | - |
| OLL87_RS11365 (2350986) | 2350986..2351312 | - | 327 | WP_002394268.1 | nucleotidyltransferase domain-containing protein | - |
| OLL87_RS11370 (2351372) | 2351372..2351686 | - | 315 | WP_002371431.1 | hypothetical protein | - |
| OLL87_RS11375 (2351706) | 2351706..2351858 | - | 153 | WP_002371433.1 | hypothetical protein | - |
| OLL87_RS11380 (2352085) | 2352085..2352273 | + | 189 | WP_002371434.1 | hypothetical protein | - |
| OLL87_RS11385 (2352461) | 2352461..2352859 | - | 399 | WP_002371435.1 | DUF961 family protein | - |
| OLL87_RS11390 (2352859) | 2352859..2353185 | - | 327 | WP_002371436.1 | hypothetical protein | - |
| OLL87_RS11395 (2353271) | 2353271..2353522 | - | 252 | WP_002365227.1 | hypothetical protein | - |
| OLL87_RS11400 (2354276) | 2354276..2354662 | + | 387 | WP_083578778.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL87_RS11405 (2354659) | 2354659..2355312 | + | 654 | WP_002365229.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| OLL87_RS11410 (2355351) | 2355351..2355686 | + | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
| OLL87_RS11415 (2355724) | 2355724..2357055 | - | 1332 | WP_002365232.1 | FAD-dependent oxidoreductase | - |
| OLL87_RS11420 (2357155) | 2357155..2358030 | - | 876 | WP_002380881.1 | aldo/keto reductase | - |
| OLL87_RS11425 (2358106) | 2358106..2358525 | - | 420 | WP_002380882.1 | MerR family transcriptional regulator | - |
| OLL87_RS11430 (2358542) | 2358542..2359123 | - | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
| OLL87_RS11435 (2359345) | 2359345..2359674 | + | 330 | WP_083578777.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | EF3023 | 2338899..2588841 | 249942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26065.01 Da Isoelectric Point: 6.2394
>T262901 WP_002365229.1 NZ_CP110053:2354659-2355312 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15168.01 Da Isoelectric Point: 4.9147
>AT262901 WP_083578778.1 NZ_CP110053:2354276-2354662 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPTPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPTPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|