262900

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1682311..1683004 Replicon chromosome
Accession NZ_CP110053
Organism Enterococcus faecalis strain BE25

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag OLL87_RS08255 Protein ID WP_002378467.1
Coordinates 1682660..1683004 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL87_RS08250 Protein ID WP_002364355.1
Coordinates 1682311..1682643 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL87_RS08205 (1677783) 1677783..1678517 - 735 WP_002381724.1 ERF family protein -
OLL87_RS08210 (1678510) 1678510..1678827 - 318 WP_002401330.1 hypothetical protein -
OLL87_RS08215 (1679047) 1679047..1679601 + 555 WP_002357006.1 hypothetical protein -
OLL87_RS08220 (1680028) 1680028..1680222 - 195 WP_002381722.1 hypothetical protein -
OLL87_RS08225 (1680259) 1680259..1680468 - 210 WP_002381721.1 hypothetical protein -
OLL87_RS08230 (1680523) 1680523..1680711 + 189 WP_002357001.1 YegP family protein -
OLL87_RS08235 (1680737) 1680737..1681462 - 726 WP_002381720.1 phage regulatory protein -
OLL87_RS08240 (1681501) 1681501..1681812 - 312 WP_002381719.1 hypothetical protein -
OLL87_RS08245 (1681823) 1681823..1681999 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL87_RS08250 (1682311) 1682311..1682643 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL87_RS08255 (1682660) 1682660..1683004 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL87_RS08260 (1683040) 1683040..1683219 + 180 WP_264547620.1 hypothetical protein -
OLL87_RS08265 (1683316) 1683316..1684275 + 960 WP_002355175.1 IS30-like element IS1062 family transposase -
OLL87_RS08270 (1684294) 1684294..1684833 + 540 WP_264547738.1 potassium channel family protein -
OLL87_RS08275 (1684933) 1684933..1686081 + 1149 WP_002381716.1 site-specific integrase -
OLL87_RS08280 (1686109) 1686109..1686552 - 444 WP_127336257.1 competence type IV pilus minor pilin ComGD -
OLL87_RS08285 (1686549) 1686549..1686824 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL87_RS08290 (1686824) 1686824..1687870 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1645704..1686525 40821
- flank IS/Tn - - 1683316..1684275 959


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T262900 WP_002378467.1 NZ_CP110053:1682660-1683004 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT262900 WP_002364355.1 NZ_CP110053:1682311-1682643 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References