Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1682311..1683004 | Replicon | chromosome |
| Accession | NZ_CP110053 | ||
| Organism | Enterococcus faecalis strain BE25 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | OLL87_RS08255 | Protein ID | WP_002378467.1 |
| Coordinates | 1682660..1683004 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLL87_RS08250 | Protein ID | WP_002364355.1 |
| Coordinates | 1682311..1682643 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL87_RS08205 (1677783) | 1677783..1678517 | - | 735 | WP_002381724.1 | ERF family protein | - |
| OLL87_RS08210 (1678510) | 1678510..1678827 | - | 318 | WP_002401330.1 | hypothetical protein | - |
| OLL87_RS08215 (1679047) | 1679047..1679601 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| OLL87_RS08220 (1680028) | 1680028..1680222 | - | 195 | WP_002381722.1 | hypothetical protein | - |
| OLL87_RS08225 (1680259) | 1680259..1680468 | - | 210 | WP_002381721.1 | hypothetical protein | - |
| OLL87_RS08230 (1680523) | 1680523..1680711 | + | 189 | WP_002357001.1 | YegP family protein | - |
| OLL87_RS08235 (1680737) | 1680737..1681462 | - | 726 | WP_002381720.1 | phage regulatory protein | - |
| OLL87_RS08240 (1681501) | 1681501..1681812 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL87_RS08245 (1681823) | 1681823..1681999 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL87_RS08250 (1682311) | 1682311..1682643 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL87_RS08255 (1682660) | 1682660..1683004 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| OLL87_RS08260 (1683040) | 1683040..1683219 | + | 180 | WP_264547620.1 | hypothetical protein | - |
| OLL87_RS08265 (1683316) | 1683316..1684275 | + | 960 | WP_002355175.1 | IS30-like element IS1062 family transposase | - |
| OLL87_RS08270 (1684294) | 1684294..1684833 | + | 540 | WP_264547738.1 | potassium channel family protein | - |
| OLL87_RS08275 (1684933) | 1684933..1686081 | + | 1149 | WP_002381716.1 | site-specific integrase | - |
| OLL87_RS08280 (1686109) | 1686109..1686552 | - | 444 | WP_127336257.1 | competence type IV pilus minor pilin ComGD | - |
| OLL87_RS08285 (1686549) | 1686549..1686824 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| OLL87_RS08290 (1686824) | 1686824..1687870 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1645704..1686525 | 40821 | |
| - | flank | IS/Tn | - | - | 1683316..1684275 | 959 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T262900 WP_002378467.1 NZ_CP110053:1682660-1683004 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|