262879

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1816863..1817556 Replicon chromosome
Accession NZ_CP110050
Organism Enterococcus faecalis strain BE32

Toxin (Protein)


Gene name IrrE Uniprot ID A0A2Z6BTE2
Locus tag OLM04_RS08950 Protein ID WP_002364356.1
Coordinates 1817212..1817556 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLM04_RS08945 Protein ID WP_002364355.1
Coordinates 1816863..1817195 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLM04_RS08900 (1812333) 1812333..1813067 - 735 WP_002364345.1 ERF family protein -
OLM04_RS08905 (1813060) 1813060..1813377 - 318 WP_002357007.1 hypothetical protein -
OLM04_RS08910 (1813597) 1813597..1814151 + 555 WP_002357006.1 hypothetical protein -
OLM04_RS08915 (1814436) 1814436..1814774 - 339 WP_002364347.1 hypothetical protein -
OLM04_RS08920 (1814811) 1814811..1815020 - 210 WP_002399426.1 hypothetical protein -
OLM04_RS08925 (1815075) 1815075..1815263 + 189 WP_002364350.1 YegP family protein -
OLM04_RS08930 (1815289) 1815289..1816014 - 726 WP_002364352.1 phage regulatory protein -
OLM04_RS08935 (1816053) 1816053..1816364 - 312 WP_002381719.1 hypothetical protein -
OLM04_RS08940 (1816375) 1816375..1816551 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLM04_RS08945 (1816863) 1816863..1817195 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLM04_RS08950 (1817212) 1817212..1817556 + 345 WP_002364356.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLM04_RS08955 (1817650) 1817650..1818555 + 906 WP_016630909.1 DUF4352 domain-containing protein -
OLM04_RS08960 (1818615) 1818615..1818689 + 75 Protein_1735 ImmA/IrrE family metallo-endopeptidase -
OLM04_RS08965 (1818723) 1818723..1819451 + 729 WP_002364358.1 potassium channel family protein -
OLM04_RS08970 (1819548) 1819548..1820696 + 1149 WP_002364359.1 site-specific integrase -
OLM04_RS08975 (1820724) 1820724..1821167 - 444 WP_002356992.1 competence type IV pilus minor pilin ComGD -
OLM04_RS08980 (1821164) 1821164..1821439 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLM04_RS08985 (1821439) 1821439..1822485 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1781896..1839544 57648


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13704.62 Da        Isoelectric Point: 5.8535

>T262879 WP_002364356.1 NZ_CP110050:1817212-1817556 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT262879 WP_002364355.1 NZ_CP110050:1816863-1817195 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6BTE2

Antitoxin

Source ID Structure

References