Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1816863..1817556 | Replicon | chromosome |
| Accession | NZ_CP110050 | ||
| Organism | Enterococcus faecalis strain BE32 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | A0A2Z6BTE2 |
| Locus tag | OLM04_RS08950 | Protein ID | WP_002364356.1 |
| Coordinates | 1817212..1817556 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLM04_RS08945 | Protein ID | WP_002364355.1 |
| Coordinates | 1816863..1817195 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM04_RS08900 (1812333) | 1812333..1813067 | - | 735 | WP_002364345.1 | ERF family protein | - |
| OLM04_RS08905 (1813060) | 1813060..1813377 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| OLM04_RS08910 (1813597) | 1813597..1814151 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| OLM04_RS08915 (1814436) | 1814436..1814774 | - | 339 | WP_002364347.1 | hypothetical protein | - |
| OLM04_RS08920 (1814811) | 1814811..1815020 | - | 210 | WP_002399426.1 | hypothetical protein | - |
| OLM04_RS08925 (1815075) | 1815075..1815263 | + | 189 | WP_002364350.1 | YegP family protein | - |
| OLM04_RS08930 (1815289) | 1815289..1816014 | - | 726 | WP_002364352.1 | phage regulatory protein | - |
| OLM04_RS08935 (1816053) | 1816053..1816364 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| OLM04_RS08940 (1816375) | 1816375..1816551 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLM04_RS08945 (1816863) | 1816863..1817195 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLM04_RS08950 (1817212) | 1817212..1817556 | + | 345 | WP_002364356.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| OLM04_RS08955 (1817650) | 1817650..1818555 | + | 906 | WP_016630909.1 | DUF4352 domain-containing protein | - |
| OLM04_RS08960 (1818615) | 1818615..1818689 | + | 75 | Protein_1735 | ImmA/IrrE family metallo-endopeptidase | - |
| OLM04_RS08965 (1818723) | 1818723..1819451 | + | 729 | WP_002364358.1 | potassium channel family protein | - |
| OLM04_RS08970 (1819548) | 1819548..1820696 | + | 1149 | WP_002364359.1 | site-specific integrase | - |
| OLM04_RS08975 (1820724) | 1820724..1821167 | - | 444 | WP_002356992.1 | competence type IV pilus minor pilin ComGD | - |
| OLM04_RS08980 (1821164) | 1821164..1821439 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| OLM04_RS08985 (1821439) | 1821439..1822485 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1781896..1839544 | 57648 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13704.62 Da Isoelectric Point: 5.8535
>T262879 WP_002364356.1 NZ_CP110050:1817212-1817556 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|