Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 388688..389270 | Replicon | chromosome |
Accession | NZ_CP110050 | ||
Organism | Enterococcus faecalis strain BE32 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | OLM04_RS01975 | Protein ID | WP_002355414.1 |
Coordinates | 388962..389270 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | OLM04_RS01970 | Protein ID | WP_002326825.1 |
Coordinates | 388688..388960 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM04_RS01950 (383907) | 383907..384308 | - | 402 | WP_002364925.1 | sigma-70 family RNA polymerase sigma factor | - |
OLM04_RS01960 (387531) | 387531..388385 | + | 855 | WP_002364921.1 | ParA family protein | - |
OLM04_RS01965 (388456) | 388456..388671 | + | 216 | WP_002364919.1 | peptide-binding protein | - |
OLM04_RS01970 (388688) | 388688..388960 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
OLM04_RS01975 (388962) | 388962..389270 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
OLM04_RS01980 (389350) | 389350..389772 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
OLM04_RS01985 (389823) | 389823..390323 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
OLM04_RS01990 (390328) | 390328..391095 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OLM04_RS01995 (391583) | 391583..392008 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
OLM04_RS02000 (392025) | 392025..392540 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
OLM04_RS02005 (392551) | 392551..393483 | + | 933 | WP_264522665.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T262876 WP_002355414.1 NZ_CP110050:388962-389270 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |