Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2808883..2809454 | Replicon | chromosome |
Accession | NZ_CP110047 | ||
Organism | Enterococcus faecalis strain BE33 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OLL90_RS13620 | Protein ID | WP_002354774.1 |
Coordinates | 2808883..2809224 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | OLL90_RS13625 | Protein ID | WP_002354773.1 |
Coordinates | 2809224..2809454 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL90_RS13615 (2804898) | 2804898..2808513 | - | 3616 | Protein_2657 | DNA-directed RNA polymerase subunit beta | - |
OLL90_RS13620 (2808883) | 2808883..2809224 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OLL90_RS13625 (2809224) | 2809224..2809454 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
OLL90_RS13630 (2809860) | 2809860..2810075 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
OLL90_RS13635 (2810214) | 2810214..2811206 | + | 993 | WP_002365428.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
OLL90_RS13640 (2811273) | 2811273..2811905 | - | 633 | WP_002358972.1 | RloB family protein | - |
OLL90_RS13645 (2811914) | 2811914..2813209 | - | 1296 | WP_002371641.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T262866 WP_002354774.1 NZ_CP110047:c2809224-2808883 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|