Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2485096..2485886 | Replicon | chromosome |
| Accession | NZ_CP110047 | ||
| Organism | Enterococcus faecalis strain BE33 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | OLL90_RS12100 | Protein ID | WP_033627270.1 |
| Coordinates | 2485497..2485886 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | OLL90_RS12095 | Protein ID | WP_002402312.1 |
| Coordinates | 2485096..2485482 (+) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL90_RS12045 (2480792) | 2480792..2481361 | - | 570 | Protein_2343 | cell division protein FtsK | - |
| OLL90_RS12050 (2481449) | 2481449..2481829 | - | 381 | WP_002402315.1 | DUF86 domain-containing protein | - |
| OLL90_RS12055 (2481819) | 2481819..2482145 | - | 327 | WP_002394268.1 | nucleotidyltransferase domain-containing protein | - |
| OLL90_RS12060 (2482205) | 2482205..2482498 | - | 294 | WP_029655860.1 | hypothetical protein | - |
| OLL90_RS12065 (2482540) | 2482540..2482692 | - | 153 | WP_002371433.1 | hypothetical protein | - |
| OLL90_RS12070 (2482919) | 2482919..2483107 | + | 189 | WP_002371434.1 | hypothetical protein | - |
| OLL90_RS12075 (2483094) | 2483094..2483255 | - | 162 | WP_002380875.1 | hypothetical protein | - |
| OLL90_RS12080 (2483278) | 2483278..2483694 | - | 417 | WP_002380876.1 | DUF961 family protein | - |
| OLL90_RS12085 (2483694) | 2483694..2484020 | - | 327 | WP_002365226.1 | hypothetical protein | - |
| OLL90_RS12090 (2484106) | 2484106..2484357 | - | 252 | WP_010777935.1 | hypothetical protein | - |
| OLL90_RS12095 (2485096) | 2485096..2485482 | + | 387 | WP_002402312.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OLL90_RS12100 (2485497) | 2485497..2485886 | + | 390 | WP_033627270.1 | hypothetical protein | Toxin |
| OLL90_RS12105 (2486154) | 2486154..2486489 | + | 336 | WP_002402309.1 | helix-turn-helix domain-containing protein | - |
| OLL90_RS12110 (2486527) | 2486527..2487858 | - | 1332 | WP_002402308.1 | FAD-dependent oxidoreductase | - |
| OLL90_RS12115 (2487957) | 2487957..2488832 | - | 876 | WP_010785430.1 | aldo/keto reductase | - |
| OLL90_RS12120 (2488909) | 2488909..2489328 | - | 420 | WP_002380882.1 | MerR family transcriptional regulator | - |
| OLL90_RS12125 (2489345) | 2489345..2489925 | - | 581 | Protein_2359 | phosphoglycerate mutase family protein | - |
| OLL90_RS12130 (2490125) | 2490125..2490474 | + | 350 | Protein_2360 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2419254..2486372 | 67118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15501.78 Da Isoelectric Point: 5.0434
>T262858 WP_033627270.1 NZ_CP110047:2485497-2485886 [Enterococcus faecalis]
VDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDEVIITTN
KELMLERKNFTKMHEVIHYYIDIPKINNATHTFSDILLKNGYLMEDFPK
VDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDEVIITTN
KELMLERKNFTKMHEVIHYYIDIPKINNATHTFSDILLKNGYLMEDFPK
Download Length: 390 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15181.05 Da Isoelectric Point: 4.7886
>AT262858 WP_002402312.1 NZ_CP110047:2485096-2485482 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKD
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKD
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|