262857

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1816931..1817624 Replicon chromosome
Accession NZ_CP110047
Organism Enterococcus faecalis strain BE33

Toxin (Protein)


Gene name IrrE Uniprot ID A0A2Z6BTE2
Locus tag OLL90_RS08965 Protein ID WP_002364356.1
Coordinates 1817280..1817624 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OLL90_RS08960 Protein ID WP_002364355.1
Coordinates 1816931..1817263 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL90_RS08915 (1812401) 1812401..1813135 - 735 WP_002364345.1 ERF family protein -
OLL90_RS08920 (1813128) 1813128..1813445 - 318 WP_002357007.1 hypothetical protein -
OLL90_RS08925 (1813665) 1813665..1814219 + 555 WP_002357006.1 hypothetical protein -
OLL90_RS08930 (1814504) 1814504..1814842 - 339 WP_002364347.1 hypothetical protein -
OLL90_RS08935 (1814879) 1814879..1815088 - 210 WP_002399426.1 hypothetical protein -
OLL90_RS08940 (1815143) 1815143..1815331 + 189 WP_002364350.1 YegP family protein -
OLL90_RS08945 (1815357) 1815357..1816082 - 726 WP_002364352.1 phage regulatory protein -
OLL90_RS08950 (1816121) 1816121..1816432 - 312 WP_002381719.1 hypothetical protein -
OLL90_RS08955 (1816443) 1816443..1816619 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
OLL90_RS08960 (1816931) 1816931..1817263 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
OLL90_RS08965 (1817280) 1817280..1817624 + 345 WP_002364356.1 ImmA/IrrE family metallo-endopeptidase Toxin
OLL90_RS08970 (1817907) 1817907..1818623 + 717 WP_258528752.1 DUF4352 domain-containing protein -
OLL90_RS08975 (1818683) 1818683..1818757 + 75 Protein_1738 ImmA/IrrE family metallo-endopeptidase -
OLL90_RS08980 (1818791) 1818791..1819520 + 730 Protein_1739 ion transporter -
OLL90_RS08985 (1819617) 1819617..1820765 + 1149 WP_002364359.1 site-specific integrase -
OLL90_RS08990 (1820793) 1820793..1821236 - 444 WP_002356992.1 competence type IV pilus minor pilin ComGD -
OLL90_RS08995 (1821233) 1821233..1821508 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
OLL90_RS09000 (1821508) 1821508..1822554 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1781966..1839613 57647


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13704.62 Da        Isoelectric Point: 5.8535

>T262857 WP_002364356.1 NZ_CP110047:1817280-1817624 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT262857 WP_002364355.1 NZ_CP110047:1816931-1817263 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6BTE2

Antitoxin

Source ID Structure

References