Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 21299..22436 | Replicon | plasmid pBE43_3 |
Accession | NZ_CP110044 | ||
Organism | Enterococcus faecalis strain BE43 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | OLM01_RS14810 | Protein ID | WP_264526513.1 |
Coordinates | 21299..22162 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | - |
Locus tag | OLM01_RS14815 | Protein ID | WP_115253291.1 |
Coordinates | 22164..22436 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM01_RS14775 (OLM01_14775) | 16469..16801 | - | 333 | WP_000713503.1 | CagC family type IV secretion system protein | - |
OLM01_RS14780 (OLM01_14780) | 16825..18819 | - | 1995 | WP_264526509.1 | MobA/MobL family protein | - |
OLM01_RS14785 (OLM01_14785) | 19102..19401 | + | 300 | WP_264526510.1 | hypothetical protein | - |
OLM01_RS14790 (OLM01_14790) | 19404..19661 | + | 258 | WP_264526511.1 | hypothetical protein | - |
OLM01_RS14795 (OLM01_14795) | 19684..19989 | - | 306 | WP_264526512.1 | hypothetical protein | - |
OLM01_RS14800 (OLM01_14800) | 20023..20520 | - | 498 | WP_002300565.1 | molecular chaperone DnaJ | - |
OLM01_RS14805 (OLM01_14805) | 20540..20857 | - | 318 | WP_002338433.1 | hypothetical protein | - |
OLM01_RS14810 (OLM01_14810) | 21299..22162 | - | 864 | WP_264526513.1 | zeta toxin family protein | Toxin |
OLM01_RS14815 (OLM01_14815) | 22164..22436 | - | 273 | WP_115253291.1 | antitoxin | Antitoxin |
OLM01_RS14820 (OLM01_14820) | 22454..22669 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
OLM01_RS14825 (OLM01_14825) | 22761..23615 | - | 855 | WP_264526514.1 | ParA family protein | - |
OLM01_RS14830 (OLM01_14830) | 23761..25905 | - | 2145 | WP_264526515.1 | type IA DNA topoisomerase | - |
OLM01_RS14835 (OLM01_14835) | 25905..26522 | - | 618 | WP_001062589.1 | recombinase family protein | - |
OLM01_RS14840 (OLM01_14840) | 26536..26706 | - | 171 | WP_000713595.1 | hypothetical protein | - |
OLM01_RS14845 (OLM01_14845) | 26803..27147 | - | 345 | WP_264526516.1 | MerR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..28952 | 28952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32431.09 Da Isoelectric Point: 6.9964
>T262852 WP_264526513.1 NZ_CP110044:c22162-21299 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELLQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYSLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMILNKHQETPEFKAIQQKLESLQPPTPPIPKIPKLPGI
MANIVNFTDKQFENRLNDNLEELLQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYSLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMILNKHQETPEFKAIQQKLESLQPPTPPIPKIPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|