Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2809861..2810432 | Replicon | chromosome |
| Accession | NZ_CP110041 | ||
| Organism | Enterococcus faecalis strain BE43 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OLM01_RS13780 | Protein ID | WP_002354774.1 |
| Coordinates | 2809861..2810202 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | OLM01_RS13785 | Protein ID | WP_002354773.1 |
| Coordinates | 2810202..2810432 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM01_RS13775 (2805876) | 2805876..2809490 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| OLM01_RS13780 (2809861) | 2809861..2810202 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OLM01_RS13785 (2810202) | 2810202..2810432 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| OLM01_RS13790 (2810763) | 2810763..2810978 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| OLM01_RS13795 (2811117) | 2811117..2812109 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLM01_RS13800 (2812373) | 2812373..2813011 | - | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
| OLM01_RS13805 (2813697) | 2813697..2815313 | + | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T262837 WP_002354774.1 NZ_CP110041:c2810202-2809861 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|