Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 433209..433761 | Replicon | chromosome |
Accession | NZ_CP110041 | ||
Organism | Enterococcus faecalis strain BE43 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | OLM01_RS02245 | Protein ID | WP_002355414.1 |
Coordinates | 433453..433761 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | - |
Locus tag | OLM01_RS02240 | Protein ID | WP_034439854.1 |
Coordinates | 433209..433451 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM01_RS02220 (428860) | 428860..430536 | + | 1677 | WP_010709001.1 | type IA DNA topoisomerase | - |
OLM01_RS02230 (432022) | 432022..432876 | + | 855 | WP_002364921.1 | ParA family protein | - |
OLM01_RS02235 (432947) | 432947..433162 | + | 216 | WP_002364919.1 | peptide-binding protein | - |
OLM01_RS02240 (433209) | 433209..433451 | + | 243 | WP_034439854.1 | antitoxin | Antitoxin |
OLM01_RS02245 (433453) | 433453..433761 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
OLM01_RS02250 (433841) | 433841..434263 | - | 423 | WP_229236149.1 | tyrosine-type recombinase/integrase | - |
OLM01_RS02255 (434314) | 434314..434814 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
OLM01_RS02260 (434819) | 434819..435586 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OLM01_RS02265 (436066) | 436066..436491 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
OLM01_RS02270 (436508) | 436508..437023 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
OLM01_RS02275 (437034) | 437034..437966 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | ClpL | - | 376839..434814 | 57975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T262826 WP_002355414.1 NZ_CP110041:433453-433761 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|