Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 2356714..2357296 | Replicon | chromosome |
Accession | NZ_CP110036 | ||
Organism | Enterococcus faecalis strain BE52 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | OLL99_RS11335 | Protein ID | WP_002355414.1 |
Coordinates | 2356988..2357296 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | OLL99_RS11330 | Protein ID | WP_002326825.1 |
Coordinates | 2356714..2356986 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL99_RS11310 (2352395) | 2352395..2354071 | + | 1677 | WP_010709001.1 | type IA DNA topoisomerase | - |
OLL99_RS11320 (2355557) | 2355557..2356411 | + | 855 | WP_015212161.1 | ParA family protein | - |
OLL99_RS11325 (2356482) | 2356482..2356697 | + | 216 | WP_002355411.1 | peptide-binding protein | - |
OLL99_RS11330 (2356714) | 2356714..2356986 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
OLL99_RS11335 (2356988) | 2356988..2357296 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
OLL99_RS11340 (2357376) | 2357376..2357798 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
OLL99_RS11345 (2357849) | 2357849..2358349 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
OLL99_RS11350 (2358354) | 2358354..2359121 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OLL99_RS11355 (2359610) | 2359610..2360035 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
OLL99_RS11360 (2360052) | 2360052..2360567 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
OLL99_RS11365 (2360578) | 2360578..2361510 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T262803 WP_002355414.1 NZ_CP110036:2356988-2357296 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |