Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 610303..611339 | Replicon | chromosome |
Accession | NZ_CP110020 | ||
Organism | Enterococcus faecalis strain BE69 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | R3K9G6 |
Locus tag | OLM05_RS02905 | Protein ID | WP_002365229.1 |
Coordinates | 610303..610956 (-) | Length | 218 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | OLM05_RS02910 | Protein ID | WP_002402312.1 |
Coordinates | 610953..611339 (-) | Length | 129 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM05_RS02875 (605943) | 605943..606272 | - | 330 | WP_010715435.1 | helix-turn-helix domain-containing protein | - |
OLM05_RS02880 (606494) | 606494..607075 | + | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
OLM05_RS02885 (607092) | 607092..607511 | + | 420 | WP_010715434.1 | MerR family transcriptional regulator | - |
OLM05_RS02890 (607526) | 607526..608461 | + | 936 | WP_181039472.1 | aldo/keto reductase | - |
OLM05_RS02895 (608560) | 608560..609891 | + | 1332 | WP_002380880.1 | FAD-dependent oxidoreductase | - |
OLM05_RS02900 (609929) | 609929..610264 | - | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
OLM05_RS02905 (610303) | 610303..610956 | - | 654 | WP_002365229.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
OLM05_RS02910 (610953) | 610953..611339 | - | 387 | WP_002402312.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OLM05_RS02915 (612093) | 612093..612344 | + | 252 | WP_002365227.1 | hypothetical protein | - |
OLM05_RS02920 (612430) | 612430..612756 | + | 327 | WP_010715432.1 | hypothetical protein | - |
OLM05_RS02925 (612756) | 612756..613172 | + | 417 | WP_002380876.1 | DUF961 family protein | - |
OLM05_RS02930 (613195) | 613195..613356 | + | 162 | WP_002394272.1 | hypothetical protein | - |
OLM05_RS02935 (613343) | 613343..613531 | - | 189 | WP_002394271.1 | hypothetical protein | - |
OLM05_RS02940 (613758) | 613758..613910 | + | 153 | WP_002410057.1 | hypothetical protein | - |
OLM05_RS02945 (613951) | 613951..614244 | + | 294 | WP_264516862.1 | hypothetical protein | - |
OLM05_RS02950 (614304) | 614304..614630 | + | 327 | WP_010715430.1 | nucleotidyltransferase domain-containing protein | - |
OLM05_RS02955 (614620) | 614620..615000 | + | 381 | WP_002394266.1 | DUF86 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 592930..651061 | 58131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26065.01 Da Isoelectric Point: 6.2394
>T262775 WP_002365229.1 NZ_CP110020:c610956-610303 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15181.05 Da Isoelectric Point: 4.7886
>AT262775 WP_002402312.1 NZ_CP110020:c611339-610953 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKD
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKD
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|