Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3133657..3134311 | Replicon | chromosome |
Accession | NZ_CP110018 | ||
Organism | Escherichia coli strain DH10B |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | OLR78_RS15420 | Protein ID | WP_000244777.1 |
Coordinates | 3133657..3134064 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OLR78_RS15425 | Protein ID | WP_000354046.1 |
Coordinates | 3134045..3134311 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR78_RS15400 (3129614) | 3129614..3131347 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OLR78_RS15405 (3131353) | 3131353..3132063 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OLR78_RS15410 (3132088) | 3132088..3132984 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OLR78_RS15415 (3133096) | 3133096..3133617 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
OLR78_RS15420 (3133657) | 3133657..3134064 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
OLR78_RS15425 (3134045) | 3134045..3134311 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OLR78_RS15430 (3134554) | 3134554..3135534 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
OLR78_RS15435 (3135730) | 3135730..3136389 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
OLR78_RS15440 (3136553) | 3136553..3136864 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
OLR78_RS15445 (3136909) | 3136909..3138342 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
OLR78_RS15450 (3138399) | 3138399..3139142 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T262755 WP_000244777.1 NZ_CP110018:c3134064-3133657 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |