Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 418645..419263 | Replicon | chromosome |
Accession | NZ_CP110018 | ||
Organism | Escherichia coli strain DH10B |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | OLR78_RS02100 | Protein ID | WP_001290581.1 |
Coordinates | 418645..418863 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | OLR78_RS02105 | Protein ID | WP_000344800.1 |
Coordinates | 418889..419263 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR78_RS02065 (413934) | 413934..414506 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
OLR78_RS02070 (414537) | 414537..414848 | - | 312 | WP_000409911.1 | MGMT family protein | - |
OLR78_RS02080 (415227) | 415227..415580 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
OLR78_RS02085 (415622) | 415622..417172 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OLR78_RS02090 (417336) | 417336..417806 | - | 471 | WP_000136192.1 | YlaC family protein | - |
OLR78_RS02095 (417922) | 417922..418473 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
OLR78_RS02100 (418645) | 418645..418863 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
OLR78_RS02105 (418889) | 418889..419263 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
OLR78_RS02110 (419809) | 419809..422958 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
OLR78_RS02115 (422981) | 422981..424174 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T262739 WP_001290581.1 NZ_CP110018:c418863-418645 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT262739 WP_000344800.1 NZ_CP110018:c419263-418889 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|