Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2868245..2868912 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | OLR76_RS14175 | Protein ID | WP_001094400.1 |
Coordinates | 2868583..2868912 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | OLR76_RS14170 | Protein ID | WP_000072690.1 |
Coordinates | 2868245..2868562 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS14135 (2863297) | 2863297..2864306 | - | 1010 | Protein_2764 | arsenic transporter | - |
OLR76_RS14140 (2864448) | 2864448..2866151 | + | 1704 | WP_000896263.1 | protein YfjW | - |
OLR76_RS14145 (2866762) | 2866762..2866946 | + | 185 | Protein_2766 | DUF905 family protein | - |
OLR76_RS14150 (2866914) | 2866914..2867036 | - | 123 | WP_001407482.1 | hypothetical protein | - |
OLR76_RS14155 (2867049) | 2867049..2867507 | + | 459 | WP_000211841.1 | antirestriction protein | - |
OLR76_RS14160 (2867516) | 2867516..2867998 | + | 483 | WP_001407480.1 | RadC family protein | - |
OLR76_RS14165 (2868007) | 2868007..2868207 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
OLR76_RS14170 (2868245) | 2868245..2868562 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OLR76_RS14175 (2868583) | 2868583..2868912 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
OLR76_RS14180 (2869276) | 2869276..2873856 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T262727 WP_001094400.1 NZ_CP110017:2868583-2868912 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EA9 | |
PDB | 2JN7 | |
AlphaFold DB | P52141 |