Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1597896..1598534 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OLR76_RS07935 | Protein ID | WP_000813794.1 |
Coordinates | 1597896..1598072 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OLR76_RS07940 | Protein ID | WP_001270286.1 |
Coordinates | 1598118..1598534 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS07915 (1593515) | 1593515..1594729 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
OLR76_RS07920 (1594782) | 1594782..1595318 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OLR76_RS07925 (1595391) | 1595391..1597352 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OLR76_RS07930 (1597444) | 1597444..1597674 | - | 231 | WP_000494244.1 | YncJ family protein | - |
OLR76_RS07935 (1597896) | 1597896..1598072 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OLR76_RS07940 (1598118) | 1598118..1598534 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OLR76_RS07945 (1598613) | 1598613..1600019 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OLR76_RS07950 (1600264) | 1600264..1601409 | + | 1146 | WP_282983529.1 | ABC transporter substrate-binding protein | - |
OLR76_RS07955 (1601427) | 1601427..1602440 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OLR76_RS07960 (1602441) | 1602441..1603382 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T262717 WP_000813794.1 NZ_CP110017:1597896-1598072 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT262717 WP_001270286.1 NZ_CP110017:1598118-1598534 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|