Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 418646..419264 | Replicon | chromosome |
| Accession | NZ_CP110017 | ||
| Organism | Escherichia coli strain HE_50 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | OLR76_RS02100 | Protein ID | WP_001290581.1 |
| Coordinates | 418646..418864 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | OLR76_RS02105 | Protein ID | WP_000344800.1 |
| Coordinates | 418890..419264 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR76_RS02065 (413935) | 413935..414507 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
| OLR76_RS02070 (414538) | 414538..414849 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| OLR76_RS02080 (415228) | 415228..415581 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| OLR76_RS02085 (415623) | 415623..417173 | - | 1551 | WP_282983422.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| OLR76_RS02090 (417337) | 417337..417807 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| OLR76_RS02095 (417923) | 417923..418474 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| OLR76_RS02100 (418646) | 418646..418864 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
| OLR76_RS02105 (418890) | 418890..419264 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| OLR76_RS02110 (419810) | 419810..422959 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| OLR76_RS02115 (422982) | 422982..424175 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T262713 WP_001290581.1 NZ_CP110017:c418864-418646 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT262713 WP_000344800.1 NZ_CP110017:c419264-418890 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|