Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 236656..237335 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | OLR76_RS01140 | Protein ID | WP_000854672.1 |
Coordinates | 236656..236997 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | OLR76_RS01145 | Protein ID | WP_000070395.1 |
Coordinates | 237018..237335 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS01115 (231933) | 231933..232334 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
OLR76_RS01120 (232373) | 232373..233428 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
OLR76_RS01125 (233716) | 233716..234819 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
OLR76_RS01130 (234831) | 234831..236084 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
OLR76_RS01140 (236656) | 236656..236997 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
OLR76_RS01145 (237018) | 237018..237335 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
OLR76_RS01150 (237354) | 237354..237575 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
OLR76_RS01155 (237584) | 237584..238060 | - | 477 | WP_000811693.1 | RadC family protein | - |
OLR76_RS01160 (238076) | 238076..238534 | - | 459 | WP_000211838.1 | antirestriction protein | - |
OLR76_RS01165 (238632) | 238632..238871 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
OLR76_RS01170 (238948) | 238948..239415 | - | 468 | WP_001547765.1 | protein YkfB | - |
OLR76_RS01175 (239438) | 239438..239881 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
OLR76_RS01180 (239881) | 239881..240108 | - | 228 | WP_282983593.1 | hypothetical protein | - |
OLR76_RS01185 (240104) | 240104..240295 | - | 192 | Protein_228 | DeoR family transcriptional regulator | - |
OLR76_RS01190 (240512) | 240512..241333 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
OLR76_RS01195 (241425) | 241425..242288 | - | 864 | WP_282983406.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T262712 WP_000854672.1 NZ_CP110017:c236997-236656 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|