Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 236656..237335 Replicon chromosome
Accession NZ_CP110017
Organism Escherichia coli strain HE_50

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag OLR76_RS01140 Protein ID WP_000854672.1
Coordinates 236656..236997 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag OLR76_RS01145 Protein ID WP_000070395.1
Coordinates 237018..237335 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLR76_RS01115 (231933) 231933..232334 + 402 WP_000174689.1 sigma factor-binding protein Crl -
OLR76_RS01120 (232373) 232373..233428 - 1056 WP_000749863.1 phosphoporin PhoE -
OLR76_RS01125 (233716) 233716..234819 + 1104 WP_001285288.1 glutamate 5-kinase -
OLR76_RS01130 (234831) 234831..236084 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
OLR76_RS01140 (236656) 236656..236997 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
OLR76_RS01145 (237018) 237018..237335 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
OLR76_RS01150 (237354) 237354..237575 - 222 WP_000691994.1 DUF987 domain-containing protein -
OLR76_RS01155 (237584) 237584..238060 - 477 WP_000811693.1 RadC family protein -
OLR76_RS01160 (238076) 238076..238534 - 459 WP_000211838.1 antirestriction protein -
OLR76_RS01165 (238632) 238632..238871 - 240 WP_000194654.1 DUF905 family protein -
OLR76_RS01170 (238948) 238948..239415 - 468 WP_001547765.1 protein YkfB -
OLR76_RS01175 (239438) 239438..239881 - 444 WP_000824223.1 lipoprotein YafY -
OLR76_RS01180 (239881) 239881..240108 - 228 WP_282983593.1 hypothetical protein -
OLR76_RS01185 (240104) 240104..240295 - 192 Protein_228 DeoR family transcriptional regulator -
OLR76_RS01190 (240512) 240512..241333 - 822 WP_000197389.1 DUF932 domain-containing protein -
OLR76_RS01195 (241425) 241425..242288 - 864 WP_282983406.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T262712 WP_000854672.1 NZ_CP110017:c236997-236656 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT262712 WP_000070395.1 NZ_CP110017:c237335-237018 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References