Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4548940..4549535 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | OLR74_RS22270 | Protein ID | WP_000239577.1 |
Coordinates | 4549185..4549535 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | OLR74_RS22265 | Protein ID | WP_001223208.1 |
Coordinates | 4548940..4549191 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS22255 (4544605) | 4544605..4548384 | + | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
OLR74_RS22260 (4548387) | 4548387..4548728 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
OLR74_RS22265 (4548940) | 4548940..4549191 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
OLR74_RS22270 (4549185) | 4549185..4549535 | + | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
OLR74_RS22275 (4549615) | 4549615..4550145 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
OLR74_RS22280 (4550455) | 4550455..4551411 | + | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
OLR74_RS22285 (4551551) | 4551551..4553053 | + | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
OLR74_RS22290 (4553067) | 4553067..4553198 | + | 132 | Protein_4339 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T262708 WP_000239577.1 NZ_CP110016:4549185-4549535 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |