Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3133650..3134304 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | OLR74_RS15430 | Protein ID | WP_000244777.1 |
Coordinates | 3133650..3134057 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OLR74_RS15435 | Protein ID | WP_000354046.1 |
Coordinates | 3134038..3134304 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS15410 (3129607) | 3129607..3131340 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OLR74_RS15415 (3131346) | 3131346..3132056 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OLR74_RS15420 (3132081) | 3132081..3132977 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OLR74_RS15425 (3133089) | 3133089..3133610 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
OLR74_RS15430 (3133650) | 3133650..3134057 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
OLR74_RS15435 (3134038) | 3134038..3134304 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OLR74_RS15440 (3134547) | 3134547..3135527 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
OLR74_RS15445 (3135723) | 3135723..3136382 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
OLR74_RS15450 (3136546) | 3136546..3136857 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
OLR74_RS15455 (3136902) | 3136902..3138335 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
OLR74_RS15460 (3138392) | 3138392..3139135 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T262703 WP_000244777.1 NZ_CP110016:c3134057-3133650 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |