Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3002660..3003243 | Replicon | chromosome |
| Accession | NZ_CP110016 | ||
| Organism | Escherichia coli strain HE_100 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | OLR74_RS14845 | Protein ID | WP_000254738.1 |
| Coordinates | 3002660..3002995 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | OLR74_RS14850 | Protein ID | WP_000581937.1 |
| Coordinates | 3002995..3003243 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR74_RS14830 (2998547) | 2998547..2999845 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| OLR74_RS14835 (2999933) | 2999933..3001570 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| OLR74_RS14840 (3001798) | 3001798..3002589 | - | 792 | WP_053899494.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| OLR74_RS14845 (3002660) | 3002660..3002995 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| OLR74_RS14850 (3002995) | 3002995..3003243 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OLR74_RS14855 (3003321) | 3003321..3005300 | - | 1980 | Protein_2902 | GTP diphosphokinase | - |
| OLR74_RS14865 (3006631) | 3006631..3006891 | - | 261 | Protein_2904 | GTP diphosphokinase | - |
| OLR74_RS14870 (3006939) | 3006939..3008240 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T262702 WP_000254738.1 NZ_CP110016:c3002995-3002660 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|