Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2868243..2868910 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | OLR74_RS14185 | Protein ID | WP_001094400.1 |
Coordinates | 2868581..2868910 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | OLR74_RS14180 | Protein ID | WP_000072690.1 |
Coordinates | 2868243..2868560 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS14145 (2863295) | 2863295..2864304 | - | 1010 | Protein_2766 | arsenic transporter | - |
OLR74_RS14150 (2864446) | 2864446..2866149 | + | 1704 | WP_000896263.1 | protein YfjW | - |
OLR74_RS14155 (2866760) | 2866760..2866944 | + | 185 | Protein_2768 | DUF905 family protein | - |
OLR74_RS14160 (2866912) | 2866912..2867034 | - | 123 | WP_001407482.1 | hypothetical protein | - |
OLR74_RS14165 (2867047) | 2867047..2867505 | + | 459 | WP_000211841.1 | antirestriction protein | - |
OLR74_RS14170 (2867514) | 2867514..2867996 | + | 483 | WP_001407480.1 | RadC family protein | - |
OLR74_RS14175 (2868005) | 2868005..2868205 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
OLR74_RS14180 (2868243) | 2868243..2868560 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OLR74_RS14185 (2868581) | 2868581..2868910 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
OLR74_RS14190 (2869274) | 2869274..2873853 | - | 4580 | Protein_2775 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T262701 WP_001094400.1 NZ_CP110016:2868581-2868910 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |