Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1597897..1598535 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OLR74_RS07945 | Protein ID | WP_000813794.1 |
Coordinates | 1597897..1598073 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OLR74_RS07950 | Protein ID | WP_001270286.1 |
Coordinates | 1598119..1598535 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS07925 (1593516) | 1593516..1594730 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
OLR74_RS07930 (1594783) | 1594783..1595319 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OLR74_RS07935 (1595392) | 1595392..1597353 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OLR74_RS07940 (1597445) | 1597445..1597675 | - | 231 | WP_000494244.1 | YncJ family protein | - |
OLR74_RS07945 (1597897) | 1597897..1598073 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OLR74_RS07950 (1598119) | 1598119..1598535 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OLR74_RS07955 (1598614) | 1598614..1600020 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OLR74_RS07960 (1600265) | 1600265..1601410 | + | 1146 | WP_282983529.1 | ABC transporter substrate-binding protein | - |
OLR74_RS07965 (1601428) | 1601428..1602441 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OLR74_RS07970 (1602442) | 1602442..1603383 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T262691 WP_000813794.1 NZ_CP110016:1597897-1598073 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT262691 WP_001270286.1 NZ_CP110016:1598119-1598535 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|