Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3002659..3003242 | Replicon | chromosome |
| Accession | NZ_CP110015 | ||
| Organism | Escherichia coli strain HE_150 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | OLR73_RS14830 | Protein ID | WP_000254738.1 |
| Coordinates | 3002659..3002994 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | OLR73_RS14835 | Protein ID | WP_000581937.1 |
| Coordinates | 3002994..3003242 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR73_RS14815 (2998546) | 2998546..2999844 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| OLR73_RS14820 (2999932) | 2999932..3001569 | - | 1638 | WP_283012198.1 | CTP synthase (glutamine hydrolyzing) | - |
| OLR73_RS14825 (3001797) | 3001797..3002588 | - | 792 | WP_053899494.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| OLR73_RS14830 (3002659) | 3002659..3002994 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| OLR73_RS14835 (3002994) | 3002994..3003242 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OLR73_RS14840 (3003320) | 3003320..3005299 | - | 1980 | Protein_2899 | GTP diphosphokinase | - |
| OLR73_RS14850 (3006630) | 3006630..3006890 | - | 261 | Protein_2901 | GTP diphosphokinase | - |
| OLR73_RS14855 (3006938) | 3006938..3008239 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T262676 WP_000254738.1 NZ_CP110015:c3002994-3002659 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|