Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 2868242..2868909 | Replicon | chromosome |
| Accession | NZ_CP110015 | ||
| Organism | Escherichia coli strain HE_150 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | OLR73_RS14170 | Protein ID | WP_001094400.1 |
| Coordinates | 2868580..2868909 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | OLR73_RS14165 | Protein ID | WP_000072690.1 |
| Coordinates | 2868242..2868559 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR73_RS14130 (2863294) | 2863294..2864303 | - | 1010 | Protein_2763 | arsenic transporter | - |
| OLR73_RS14135 (2864445) | 2864445..2866148 | + | 1704 | WP_000896263.1 | protein YfjW | - |
| OLR73_RS14140 (2866759) | 2866759..2866943 | + | 185 | Protein_2765 | DUF905 family protein | - |
| OLR73_RS14145 (2866911) | 2866911..2867033 | - | 123 | WP_001407482.1 | hypothetical protein | - |
| OLR73_RS14150 (2867046) | 2867046..2867504 | + | 459 | WP_000211841.1 | antirestriction protein | - |
| OLR73_RS14155 (2867513) | 2867513..2867995 | + | 483 | WP_001407480.1 | RadC family protein | - |
| OLR73_RS14160 (2868004) | 2868004..2868204 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| OLR73_RS14165 (2868242) | 2868242..2868559 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OLR73_RS14170 (2868580) | 2868580..2868909 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| OLR73_RS14175 (2869273) | 2869273..2873852 | - | 4580 | Protein_2772 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T262675 WP_001094400.1 NZ_CP110015:2868580-2868909 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |