Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1597895..1598533 | Replicon | chromosome |
Accession | NZ_CP110015 | ||
Organism | Escherichia coli strain HE_150 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OLR73_RS07930 | Protein ID | WP_000813794.1 |
Coordinates | 1597895..1598071 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OLR73_RS07935 | Protein ID | WP_001270286.1 |
Coordinates | 1598117..1598533 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR73_RS07910 (1593514) | 1593514..1594728 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
OLR73_RS07915 (1594781) | 1594781..1595317 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OLR73_RS07920 (1595390) | 1595390..1597351 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OLR73_RS07925 (1597443) | 1597443..1597673 | - | 231 | WP_000494244.1 | YncJ family protein | - |
OLR73_RS07930 (1597895) | 1597895..1598071 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OLR73_RS07935 (1598117) | 1598117..1598533 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OLR73_RS07940 (1598612) | 1598612..1600018 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OLR73_RS07945 (1600263) | 1600263..1601408 | + | 1146 | WP_282983529.1 | ABC transporter substrate-binding protein | - |
OLR73_RS07950 (1601426) | 1601426..1602439 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OLR73_RS07955 (1602440) | 1602440..1603382 | + | 943 | Protein_1553 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T262665 WP_000813794.1 NZ_CP110015:1597895-1598071 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT262665 WP_001270286.1 NZ_CP110015:1598117-1598533 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|