Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3002655..3003238 | Replicon | chromosome |
Accession | NZ_CP110014 | ||
Organism | Escherichia coli strain HE_100-10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | OLR77_RS14840 | Protein ID | WP_000254738.1 |
Coordinates | 3002655..3002990 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | OLR77_RS14845 | Protein ID | WP_000581937.1 |
Coordinates | 3002990..3003238 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR77_RS14825 (2998542) | 2998542..2999840 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
OLR77_RS14830 (2999928) | 2999928..3001565 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OLR77_RS14835 (3001793) | 3001793..3002584 | - | 792 | WP_053899494.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OLR77_RS14840 (3002655) | 3002655..3002990 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
OLR77_RS14845 (3002990) | 3002990..3003238 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OLR77_RS14850 (3003316) | 3003316..3005295 | - | 1980 | Protein_2901 | GTP diphosphokinase | - |
OLR77_RS14860 (3006626) | 3006626..3006886 | - | 261 | Protein_2903 | GTP diphosphokinase | - |
OLR77_RS14865 (3006934) | 3006934..3008235 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T262650 WP_000254738.1 NZ_CP110014:c3002990-3002655 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|