Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2868236..2868903 | Replicon | chromosome |
Accession | NZ_CP110014 | ||
Organism | Escherichia coli strain HE_100-10 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | OLR77_RS14180 | Protein ID | WP_001094400.1 |
Coordinates | 2868574..2868903 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | OLR77_RS14175 | Protein ID | WP_000072690.1 |
Coordinates | 2868236..2868553 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR77_RS14140 (2863288) | 2863288..2864297 | - | 1010 | Protein_2765 | arsenic transporter | - |
OLR77_RS14145 (2864439) | 2864439..2866142 | + | 1704 | WP_000896263.1 | protein YfjW | - |
OLR77_RS14150 (2866753) | 2866753..2866937 | + | 185 | Protein_2767 | DUF905 family protein | - |
OLR77_RS14155 (2866905) | 2866905..2867027 | - | 123 | WP_001407482.1 | hypothetical protein | - |
OLR77_RS14160 (2867040) | 2867040..2867498 | + | 459 | WP_000211841.1 | antirestriction protein | - |
OLR77_RS14165 (2867507) | 2867507..2867989 | + | 483 | WP_001407480.1 | RadC family protein | - |
OLR77_RS14170 (2867998) | 2867998..2868198 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
OLR77_RS14175 (2868236) | 2868236..2868553 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OLR77_RS14180 (2868574) | 2868574..2868903 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
OLR77_RS14185 (2869267) | 2869267..2873847 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T262649 WP_001094400.1 NZ_CP110014:2868574-2868903 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EA9 | |
PDB | 2JN7 | |
AlphaFold DB | P52141 |