Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1597894..1598532 | Replicon | chromosome |
Accession | NZ_CP110014 | ||
Organism | Escherichia coli strain HE_100-10 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OLR77_RS07940 | Protein ID | WP_000813794.1 |
Coordinates | 1597894..1598070 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OLR77_RS07945 | Protein ID | WP_001270286.1 |
Coordinates | 1598116..1598532 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR77_RS07920 (1593513) | 1593513..1594727 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
OLR77_RS07925 (1594780) | 1594780..1595316 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OLR77_RS07930 (1595389) | 1595389..1597350 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OLR77_RS07935 (1597442) | 1597442..1597672 | - | 231 | WP_000494244.1 | YncJ family protein | - |
OLR77_RS07940 (1597894) | 1597894..1598070 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OLR77_RS07945 (1598116) | 1598116..1598532 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OLR77_RS07950 (1598611) | 1598611..1600017 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OLR77_RS07955 (1600262) | 1600262..1601407 | + | 1146 | WP_282983529.1 | ABC transporter substrate-binding protein | - |
OLR77_RS07960 (1601425) | 1601425..1602438 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OLR77_RS07965 (1602439) | 1602439..1603380 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T262639 WP_000813794.1 NZ_CP110014:1597894-1598070 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT262639 WP_001270286.1 NZ_CP110014:1598116-1598532 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|