Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 236657..237336 Replicon chromosome
Accession NZ_CP110014
Organism Escherichia coli strain HE_100-10

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag OLR77_RS01140 Protein ID WP_000854672.1
Coordinates 236657..236998 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag OLR77_RS01145 Protein ID WP_000070395.1
Coordinates 237019..237336 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLR77_RS01115 (231934) 231934..232335 + 402 WP_000174689.1 sigma factor-binding protein Crl -
OLR77_RS01120 (232374) 232374..233429 - 1056 WP_000749863.1 phosphoporin PhoE -
OLR77_RS01125 (233717) 233717..234820 + 1104 WP_001285288.1 glutamate 5-kinase -
OLR77_RS01130 (234832) 234832..236085 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
OLR77_RS01140 (236657) 236657..236998 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
OLR77_RS01145 (237019) 237019..237336 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
OLR77_RS01150 (237355) 237355..237576 - 222 WP_000691994.1 DUF987 domain-containing protein -
OLR77_RS01155 (237585) 237585..238061 - 477 WP_000811693.1 RadC family protein -
OLR77_RS01160 (238077) 238077..238535 - 459 WP_000211838.1 antirestriction protein -
OLR77_RS01165 (238633) 238633..238872 - 240 WP_000194654.1 DUF905 family protein -
OLR77_RS01170 (238949) 238949..239416 - 468 WP_001547765.1 protein YkfB -
OLR77_RS01175 (239439) 239439..239882 - 444 WP_000824223.1 lipoprotein YafY -
OLR77_RS01180 (239882) 239882..240109 - 228 WP_282983593.1 hypothetical protein -
OLR77_RS01185 (240105) 240105..240296 - 192 Protein_228 DeoR family transcriptional regulator -
OLR77_RS01190 (240513) 240513..241334 - 822 WP_000197389.1 DUF932 domain-containing protein -
OLR77_RS01195 (241426) 241426..242289 - 864 WP_282983406.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T262634 WP_000854672.1 NZ_CP110014:c236998-236657 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT262634 WP_000070395.1 NZ_CP110014:c237336-237019 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References