Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 2726184..2726718 | Replicon | chromosome |
Accession | NZ_CP110006 | ||
Organism | Flavobacterium sp. N2469 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | OLM47_RS11665 | Protein ID | WP_257682215.1 |
Coordinates | 2726184..2726477 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | OLM47_RS11670 | Protein ID | WP_089056144.1 |
Coordinates | 2726470..2726718 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM47_RS11635 | 2721549..2722238 | + | 690 | WP_089056139.1 | response regulator transcription factor | - |
OLM47_RS11640 | 2722271..2722813 | - | 543 | WP_089056140.1 | hypothetical protein | - |
OLM47_RS11645 | 2722904..2723821 | - | 918 | WP_257682214.1 | 2-dehydropantoate 2-reductase | - |
OLM47_RS11650 | 2723937..2725187 | - | 1251 | WP_099718953.1 | cation:dicarboxylase symporter family transporter | - |
OLM47_RS11660 | 2725665..2725958 | + | 294 | WP_089056142.1 | hypothetical protein | - |
OLM47_RS11665 | 2726184..2726477 | - | 294 | WP_257682215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OLM47_RS11670 | 2726470..2726718 | - | 249 | WP_089056144.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
OLM47_RS11675 | 2726818..2727267 | - | 450 | WP_257682216.1 | nuclear transport factor 2 family protein | - |
OLM47_RS11680 | 2727325..2728119 | - | 795 | WP_099718958.1 | peptidase | - |
OLM47_RS11685 | 2728228..2728884 | + | 657 | WP_123922143.1 | hypothetical protein | - |
OLM47_RS11690 | 2728945..2730030 | + | 1086 | WP_089056148.1 | DNA polymerase III subunit gamma/tau | - |
OLM47_RS11695 | 2730104..2730256 | - | 153 | WP_257682217.1 | hypothetical protein | - |
OLM47_RS11700 | 2730240..2730683 | + | 444 | WP_257682218.1 | DNA polymerase III subunit gamma/tau | - |
OLM47_RS11705 | 2730761..2731339 | - | 579 | WP_099718961.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11443.97 Da Isoelectric Point: 4.8258
>T262631 WP_257682215.1 NZ_CP110006:c2726477-2726184 [Flavobacterium sp. N2469]
MAKYHFTNKAVEDLADIWNYTFDEWSENQADKYYLLLLDSCQELAENPNLGKKYDTVAESLFGFKSNLHILFYQIISNTE
IEVVRILHGRMDLKSKF
MAKYHFTNKAVEDLADIWNYTFDEWSENQADKYYLLLLDSCQELAENPNLGKKYDTVAESLFGFKSNLHILFYQIISNTE
IEVVRILHGRMDLKSKF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|