Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 235129..235676 | Replicon | chromosome |
Accession | NZ_CP110002 | ||
Organism | Flavobacterium sp. N2155 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | OLM43_RS01130 | Protein ID | WP_264562096.1 |
Coordinates | 235129..235428 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | OLM43_RS01135 | Protein ID | WP_264562097.1 |
Coordinates | 235428..235676 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM43_RS01110 | 231096..231860 | + | 765 | WP_264562092.1 | peroxide stress protein YaaA | - |
OLM43_RS01115 | 231954..232232 | + | 279 | WP_264562093.1 | hypothetical protein | - |
OLM43_RS01120 | 232528..232701 | - | 174 | WP_264562094.1 | hypothetical protein | - |
OLM43_RS01125 | 233755..235050 | + | 1296 | WP_264562095.1 | group II intron reverse transcriptase/maturase | - |
OLM43_RS01130 | 235129..235428 | - | 300 | WP_264562096.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OLM43_RS01135 | 235428..235676 | - | 249 | WP_264562097.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
OLM43_RS01140 | 236199..236543 | - | 345 | WP_264562098.1 | SdpI family protein | - |
OLM43_RS01145 | 236609..237067 | - | 459 | WP_264562099.1 | hypothetical protein | - |
OLM43_RS01150 | 237069..238424 | - | 1356 | WP_264562100.1 | lysophospholipase | - |
OLM43_RS01155 | 238430..239008 | - | 579 | WP_264562101.1 | YIP1 family protein | - |
OLM43_RS01160 | 239012..239284 | - | 273 | WP_257498579.1 | DUF2089 domain-containing protein | - |
OLM43_RS01165 | 239413..240339 | - | 927 | WP_264562102.1 | EamA family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 12113.75 Da Isoelectric Point: 6.4878
>T262630 WP_264562096.1 NZ_CP110002:c235428-235129 [Flavobacterium sp. N2155]
MGYKISHEANRDIENIWLYTYENWSLEQADRYINLIIDEIEYLAENPKSGKDYGHLRKGYFRSQIKSHFIFYKISLKREE
IEIIRVLHQRMDIESRLTE
MGYKISHEANRDIENIWLYTYENWSLEQADRYINLIIDEIEYLAENPKSGKDYGHLRKGYFRSQIKSHFIFYKISLKREE
IEIIRVLHQRMDIESRLTE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|