Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 439..1019 | Replicon | plasmid pKP424-7 |
Accession | NZ_CP109989 | ||
Organism | Klebsiella pneumoniae strain KP424 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OJ961_RS29610 | Protein ID | WP_071177730.1 |
Coordinates | 705..1019 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OJ961_RS29605 | Protein ID | WP_000093040.1 |
Coordinates | 439..717 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ961_RS29605 (OJ961_29610) | 439..717 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OJ961_RS29610 (OJ961_29615) | 705..1019 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OJ961_RS29615 (OJ961_29620) | 1183..1611 | + | 429 | WP_001140599.1 | hypothetical protein | - |
OJ961_RS29620 (OJ961_29625) | 1637..1816 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OJ961_RS29625 (OJ961_29630) | 1843..2373 | - | 531 | WP_071177729.1 | hypothetical protein | - |
OJ961_RS29630 (OJ961_29635) | 2380..3111 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OJ961_RS29635 (OJ961_29640) | 3111..5075 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T262628 WP_071177730.1 NZ_CP109989:705-1019 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|