Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 19167..19702 | Replicon | plasmid pKP424-5 |
Accession | NZ_CP109987 | ||
Organism | Klebsiella pneumoniae strain KP424 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OJ961_RS29195 | Protein ID | WP_016531292.1 |
Coordinates | 19167..19454 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A837JUA1 |
Locus tag | OJ961_RS29200 | Protein ID | WP_023317799.1 |
Coordinates | 19451..19702 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ961_RS29175 (OJ961_29180) | 14724..15479 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
OJ961_RS29180 (OJ961_29185) | 16296..16826 | + | 531 | WP_023317796.1 | hypothetical protein | - |
OJ961_RS29185 (OJ961_29190) | 17080..17367 | - | 288 | WP_016529486.1 | hypothetical protein | - |
OJ961_RS29190 (OJ961_29195) | 17457..18119 | - | 663 | WP_023317797.1 | division plane positioning ATPase MipZ | - |
OJ961_RS29195 (OJ961_29200) | 19167..19454 | - | 288 | WP_016531292.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OJ961_RS29200 (OJ961_29205) | 19451..19702 | - | 252 | WP_023317799.1 | hypothetical protein | Antitoxin |
OJ961_RS29205 (OJ961_29210) | 19798..21066 | - | 1269 | WP_023317800.1 | Y-family DNA polymerase | - |
OJ961_RS29210 (OJ961_29215) | 21066..21497 | - | 432 | WP_023317801.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
OJ961_RS29215 (OJ961_29220) | 21903..23390 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
OJ961_RS29220 (OJ961_29225) | 23639..24610 | + | 972 | WP_004152353.1 | plasmid segregation protein ParM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81442 | 81442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11120.16 Da Isoelectric Point: 10.4373
>T262626 WP_016531292.1 NZ_CP109987:c19454-19167 [Klebsiella pneumoniae]
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|