Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1904..2481 | Replicon | plasmid pKP424-5 |
Accession | NZ_CP109987 | ||
Organism | Klebsiella pneumoniae strain KP424 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7G3NNX6 |
Locus tag | OJ961_RS29075 | Protein ID | WP_059065587.1 |
Coordinates | 2149..2481 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7G3NP82 |
Locus tag | OJ961_RS29070 | Protein ID | WP_032454911.1 |
Coordinates | 1904..2149 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ961_RS29070 (OJ961_29075) | 1904..2149 | + | 246 | WP_032454911.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OJ961_RS29075 (OJ961_29080) | 2149..2481 | + | 333 | WP_059065587.1 | endoribonuclease MazF | Toxin |
OJ961_RS29080 (OJ961_29085) | 2741..3064 | + | 324 | WP_021312689.1 | hypothetical protein | - |
OJ961_RS29085 (OJ961_29090) | 3315..4019 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
OJ961_RS29090 (OJ961_29095) | 4179..5525 | - | 1347 | WP_188201154.1 | ISNCY family transposase | - |
OJ961_RS29095 (OJ961_29100) | 5738..5992 | - | 255 | WP_065810046.1 | hypothetical protein | - |
OJ961_RS29100 (OJ961_29105) | 6068..6325 | - | 258 | WP_047665813.1 | hypothetical protein | - |
OJ961_RS29105 (OJ961_29110) | 6374..6577 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
OJ961_RS29110 (OJ961_29115) | 6611..6979 | - | 369 | WP_122462932.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81442 | 81442 | |
- | flank | IS/Tn | - | - | 4179..5537 | 1358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11991.87 Da Isoelectric Point: 7.7494
>T262625 WP_059065587.1 NZ_CP109987:2149-2481 [Klebsiella pneumoniae]
MVSRFVPDAGDLIWINFDPVEGHEQGGHRPAVVLSPFAYNNKTGLLLCVPCTTKVKGYPFEVELPGERDGVALADQITCV
DWRARKVEKKGKVATGELSEIRAKAKALIG
MVSRFVPDAGDLIWINFDPVEGHEQGGHRPAVVLSPFAYNNKTGLLLCVPCTTKVKGYPFEVELPGERDGVALADQITCV
DWRARKVEKKGKVATGELSEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G3NNX6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G3NP82 |