Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 7394..7919 | Replicon | plasmid pNDM-1-KP424 |
Accession | NZ_CP109986 | ||
Organism | Klebsiella pneumoniae strain KP424 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | W8EAA6 |
Locus tag | OJ961_RS28570 | Protein ID | WP_008322213.1 |
Coordinates | 7394..7699 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A6C0NE25 |
Locus tag | OJ961_RS28575 | Protein ID | WP_032934863.1 |
Coordinates | 7701..7919 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ961_RS28540 (OJ961_28545) | 2531..2647 | + | 117 | Protein_2 | IS5 family transposase | - |
OJ961_RS28545 (OJ961_28550) | 2719..3839 | + | 1121 | WP_089046468.1 | IS3-like element ISSen4 family transposase | - |
OJ961_RS28550 (OJ961_28555) | 3868..4614 | + | 747 | Protein_4 | IS5-like element IS5 family transposase | - |
OJ961_RS28555 (OJ961_28560) | 4776..6098 | + | 1323 | WP_016479957.1 | GntP family transporter | - |
OJ961_RS28560 (OJ961_28565) | 6297..7088 | - | 792 | WP_008322208.1 | site-specific integrase | - |
OJ961_RS28565 (OJ961_28570) | 7078..7392 | - | 315 | WP_008322211.1 | hypothetical protein | - |
OJ961_RS28570 (OJ961_28575) | 7394..7699 | - | 306 | WP_008322213.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OJ961_RS28575 (OJ961_28580) | 7701..7919 | - | 219 | WP_032934863.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OJ961_RS28590 (OJ961_28595) | 10367..11335 | - | 969 | WP_000654811.1 | IS5 family transposase | - |
OJ961_RS28595 (OJ961_28600) | 11396..12028 | - | 633 | WP_016479950.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaNDM-1 | htpB | 1..86272 | 86272 | |
- | inside | IScluster/Tn | - | - | 2531..11290 | 8759 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11450.23 Da Isoelectric Point: 5.8211
>T262624 WP_008322213.1 NZ_CP109986:c7699-7394 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C0NE27 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C0NE25 |