Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6993..7636 Replicon plasmid pKP424-3
Accession NZ_CP109985
Organism Klebsiella pneumoniae strain KP424

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OJ961_RS28005 Protein ID WP_001044770.1
Coordinates 7220..7636 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OJ961_RS28000 Protein ID WP_001261282.1
Coordinates 6993..7223 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ961_RS27960 (2174) 2174..2476 + 303 WP_004197636.1 hypothetical protein -
OJ961_RS27965 (2956) 2956..3750 - 795 WP_004197635.1 site-specific integrase -
OJ961_RS27970 (3948) 3948..4964 - 1017 WP_017899884.1 hypothetical protein -
OJ961_RS27975 (4975) 4975..5289 - 315 WP_053389906.1 hypothetical protein -
OJ961_RS27980 (5316) 5316..5711 - 396 WP_017899885.1 hypothetical protein -
OJ961_RS27985 (5880) 5880..6185 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
OJ961_RS27990 (6187) 6187..6405 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
OJ961_RS27995 (6575) 6575..7036 - 462 WP_160880186.1 hypothetical protein -
OJ961_RS28000 (6993) 6993..7223 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OJ961_RS28005 (7220) 7220..7636 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OJ961_RS28010 (7710) 7710..9272 + 1563 WP_004206609.1 AAA family ATPase -
OJ961_RS28015 (9257) 9257..10279 + 1023 WP_000361404.1 helicase UvrD -
OJ961_RS28020 (10535) 10535..11232 + 698 WP_223174630.1 IS1 family transposase -
OJ961_RS28025 (11261) 11261..11533 + 273 Protein_15 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..93565 93565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T262623 WP_001044770.1 NZ_CP109985:7220-7636 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT262623 WP_001261282.1 NZ_CP109985:6993-7223 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References