Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 6993..7636 | Replicon | plasmid pKP424-3 |
| Accession | NZ_CP109985 | ||
| Organism | Klebsiella pneumoniae strain KP424 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OJ961_RS28005 | Protein ID | WP_001044770.1 |
| Coordinates | 7220..7636 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OJ961_RS28000 | Protein ID | WP_001261282.1 |
| Coordinates | 6993..7223 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OJ961_RS27960 (2174) | 2174..2476 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| OJ961_RS27965 (2956) | 2956..3750 | - | 795 | WP_004197635.1 | site-specific integrase | - |
| OJ961_RS27970 (3948) | 3948..4964 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
| OJ961_RS27975 (4975) | 4975..5289 | - | 315 | WP_053389906.1 | hypothetical protein | - |
| OJ961_RS27980 (5316) | 5316..5711 | - | 396 | WP_017899885.1 | hypothetical protein | - |
| OJ961_RS27985 (5880) | 5880..6185 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | - |
| OJ961_RS27990 (6187) | 6187..6405 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| OJ961_RS27995 (6575) | 6575..7036 | - | 462 | WP_160880186.1 | hypothetical protein | - |
| OJ961_RS28000 (6993) | 6993..7223 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OJ961_RS28005 (7220) | 7220..7636 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OJ961_RS28010 (7710) | 7710..9272 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OJ961_RS28015 (9257) | 9257..10279 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| OJ961_RS28020 (10535) | 10535..11232 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| OJ961_RS28025 (11261) | 11261..11533 | + | 273 | Protein_15 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..93565 | 93565 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T262623 WP_001044770.1 NZ_CP109985:7220-7636 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |